Anti-CCDC43

Catalog Number: ATA-HPA023391
Article Name: Anti-CCDC43
Biozol Catalog Number: ATA-HPA023391
Supplier Catalog Number: HPA023391
Alternative Catalog Number: ATA-HPA023391-100,ATA-HPA023391-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC, IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: FLJ31795
coiled-coil domain containing 43
Anti-CCDC43
Clonality: Polyclonal
Concentration: 0.7 mg/ml
Isotype: IgG
NCBI: 124808
UniProt: Q96MW1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: SGATTMNIGSDKLLFRNTNVEDVLNARKLERDSLRDESQRKKEQDKLQRERDKLAKQERKE
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: CCDC43
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemical staining of human duodenum shows strong cytoplasmic positivity in glandular cells.
Western blot analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-CCDC43 antibody. Remaining relative intensity is presented.
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
HPA023391-100ul
HPA023391-100ul
HPA023391-100ul