Anti-CDR2

Catalog Number: ATA-HPA023870
Article Name: Anti-CDR2
Biozol Catalog Number: ATA-HPA023870
Supplier Catalog Number: HPA023870
Alternative Catalog Number: ATA-HPA023870-100,ATA-HPA023870-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: CDR62, Yo
cerebellar degeneration-related protein 2, 62kDa
Anti-CDR2
Clonality: Polyclonal
Concentration: 0.2 mg/ml
Isotype: IgG
NCBI: 1039
UniProt: Q01850
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: ILSLTETIECLQTNIDHLQSQVEELKSSGQGRRSPGKCDQEKPAPSFACLKELYDLRQHFVYDHVFAEKITSLQGQPSPDEEENEHLKKTVTMLQAQLSLERQKRVTMEEEYGLVLKENSELE
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: CDR2
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Immunohistochemical staining of human breast shows distinct cytoplasmic positivity in myoepithelial cells.
Western blot analysis in human cell line HepG2.
HPA023870-100ul
HPA023870-100ul
HPA023870-100ul