Anti-C9orf72
Catalog Number:
ATA-HPA023873
- Images (7)
| Article Name: | Anti-C9orf72 |
| Biozol Catalog Number: | ATA-HPA023873 |
| Supplier Catalog Number: | HPA023873 |
| Alternative Catalog Number: | ATA-HPA023873-100,ATA-HPA023873-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | MGC23980 |
| chromosome 9 open reading frame 72 |
| Anti-C9orf72 |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 203228 |
| UniProt: | Q96LT7 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | YGLSIILPQTELSFYLPLHRVCVDRLTHIIRKGRIWMHKERQENVQKIILEGTERMEDQGQSIIPMLTGEVIPVMELLSSMKSHSVPEEI |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | C9orf72 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemical staining of human cerebral cortex shows weak to moderate cytoplasmic positivity in neurons. |
|
|
Immunohistochemical staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts. |
|
|
Immunohistochemical staining of human gastrointestinal shows strong cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human pancreas shows very weak cytoplasmic positivity in exocrine glandular cells. |
|
|
HPA023873-100ul |
|
|
HPA023873-100ul |
|
|
HPA023873-100ul |
Product Guarantee and Expert Support
