Anti-ARID5A

Catalog Number: ATA-HPA023879
Article Name: Anti-ARID5A
Biozol Catalog Number: ATA-HPA023879
Supplier Catalog Number: HPA023879
Alternative Catalog Number: ATA-HPA023879-100,ATA-HPA023879-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ChIP, ICC, IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: MRF-1, RP11-363D14
AT rich interactive domain 5A (MRF1-like)
Anti-ARID5A
Clonality: Polyclonal
Concentration: 0.3 mg/ml
Isotype: IgG
NCBI: 10865
UniProt: Q03989
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: LVLPYVRHLKGEDDKPLPTSKPRKQYKMAKENRGDDGATERPKKAKEERRMDQMMPGKTKADAADPAPLPSQEPPRNSTEQQGLASGSSVSFVGASGCPEAYKRLLSSFYCKGTH
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: ARID5A
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:1000 - 1:2500, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line A-431 shows positivity in nucleus & nucleoli.
Immunohistochemical staining of human urinary bladder shows strong nuclear positivity in urothelial cells.
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: Human cell line RT-4
HPA023879-100ul
HPA023879-100ul
HPA023879-100ul