Anti-STC1
Catalog Number:
ATA-HPA023918
- Images (7)
| Article Name: | Anti-STC1 |
| Biozol Catalog Number: | ATA-HPA023918 |
| Supplier Catalog Number: | HPA023918 |
| Alternative Catalog Number: | ATA-HPA023918-100,ATA-HPA023918-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | STC |
| stanniocalcin 1 |
| Anti-STC1 |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 6781 |
| UniProt: | P52823 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | EQNDSVSPRKSRVAAQNSAEVVRCLNSALQVGCGAFACLENSTCDTDGMYDICKSFLYSAAKFDTQGKAFVKESL |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | STC1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemical staining of human thyroid gland shows moderate cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human kidney shows weak to moderate cytoplasmic positivity in cells in tubules. |
|
|
Immunohistochemical staining of human placenta shows weak to moderate cytoplasmic positivity in trophoblastic cells. |
|
|
Immunohistochemical staining of human skeletal muscle shows no cytoplasmic positivity in myocytes as expected. |
|
|
HPA023918-100ul |
|
|
HPA023918-100ul |
|
|
HPA023918-100ul |
Product Guarantee and Expert Support
