Anti-UGCG
Catalog Number:
ATA-HPA024124
- Images (7)
| Article Name: | Anti-UGCG |
| Biozol Catalog Number: | ATA-HPA024124 |
| Supplier Catalog Number: | HPA024124 |
| Alternative Catalog Number: | ATA-HPA024124-100,ATA-HPA024124-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | GCS |
| UDP-glucose ceramide glucosyltransferase |
| Anti-UGCG |
| Clonality: | Polyclonal |
| Concentration: | 0.05 mg/ml |
| Isotype: | IgG |
| NCBI: | 7357 |
| UniProt: | Q16739 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | RLHLNKKATDKQPYSKLPGVSLLKPLKGVDPNLINNLETFFELDYPKYEVLLCVQDHDDPAIDVCKKLLGKYPNVDARLFIGGKKVGINPKINNLMPGYEVAKYDLI |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | UGCG |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemical staining of human lymphoid tissues shows strong cytoplasmic positivity in lymphoid cells. |
|
|
Immunohistochemical staining of human gastrointestinal shows moderate cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in tubules. |
|
|
Immunohistochemical staining of human endometrium shows moderate cytoplasmic positivity in glandular cells. |
|
|
HPA024124-100ul |
|
|
HPA024124-100ul |
|
|
HPA024124-100ul |
Product Guarantee and Expert Support
