Anti-ERC1

Catalog Number: ATA-HPA024130
Article Name: Anti-ERC1
Biozol Catalog Number: ATA-HPA024130
Supplier Catalog Number: HPA024130
Alternative Catalog Number: ATA-HPA024130-100,ATA-HPA024130-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC, IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: CAST2, ELKS, KIAA1081, MGC12974, RAB6IP2
ELKS/RAB6-interacting/CAST family member 1
Anti-ERC1
Clonality: Polyclonal
Concentration: 0.3 mg/ml
Isotype: IgG
NCBI: 23085
UniProt: Q8IUD2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: EEREEEMKQMEVYRSHSKFMKNKVEQLKEELSSKEAQWEELKKKAAGLQAEIGQVKQELSRKDTELLALQTKLETLINQFSD
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: ERC1
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-251 MG shows positivity in cytoplasm.
Immunohistochemical staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.
Western blot analysis using Anti-ERC1 antibody HPA024130 (A) shows similar pattern to independent antibody HPA019513 (B).
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
HPA024130-100ul
HPA024130
HPA024130
HPA024130-100ul
HPA024130-100ul