Anti-DDX6

Catalog Number: ATA-HPA024201
Article Name: Anti-DDX6
Biozol Catalog Number: ATA-HPA024201
Supplier Catalog Number: HPA024201
Alternative Catalog Number: ATA-HPA024201-100,ATA-HPA024201-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC, IHC, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: HLR2, RCK
DEAD (Asp-Glu-Ala-Asp) box helicase 6
Anti-DDX6
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 1656
UniProt: P26196
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: ENPVIMGLSSQNGQLRGPVKPTGGPGGGGTQTQQQMNQLKNTNTINNGTQQQAQSMTTTIKPGDDWKKTLKLPPKDLRIKTSDVTSTKGNEFEDYCLKRELLMGIFEMGWEKPSPIQ
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: DDX6
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line A-431 shows localization to cytoplasmic bodies.
Immunohistochemical staining of human tonsil shows strong cytoplasmic positivity in germinal and non-germinal center cells.
Western blot analysis using Anti-DDX6 antibody HPA024201 (A) shows similar pattern to independent antibody HPA026644 (B).
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
HPA024201-100ul
HPA024201-100ul
HPA024201-100ul