Anti-INCA1, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-INCA1, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA024202
• Supplier Catalog Number: HPA024202
• Alternative Catalog Number: ATA-HPA024202-100,ATA-HPA024202-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: WB
• Species Reactivity: Human

Product Description

Rabbit Polyclonal INCA1 Antibody against Human inhibitor of CDK, cyclin A1 interacting protein 1. Validated for Western Blot

Product Properties

• Clonality: Polyclonal
• Concentration: 0.1
• NCBI: 388324
• UniProt: Q0VD86
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Sequence: QDDGVNLIPFAKCSRVVSRSPPPRLPSQSLRPMPQRYGDVFWKNLNQRPTPTWLEEQHIPPMLLPPPEMLWRR