Anti-INCA1
Catalog Number:
ATA-HPA024202
| Article Name: |
Anti-INCA1 |
| Biozol Catalog Number: |
ATA-HPA024202 |
| Supplier Catalog Number: |
HPA024202 |
| Alternative Catalog Number: |
ATA-HPA024202-100,ATA-HPA024202-25 |
| Manufacturer: |
Atlas Antibodies |
| Host: |
Rabbit |
| Category: |
Sonstiges |
| Application: |
WB |
| Species Reactivity: |
Human |
| Rabbit Polyclonal INCA1 Antibody against Human inhibitor of CDK, cyclin A1 interacting protein 1. Validated for Western Blot |
| Clonality: |
Polyclonal |
| Concentration: |
0.1 |
| NCBI: |
388324 |
| UniProt: |
Q0VD86 |
| Buffer: |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Sequence: |
QDDGVNLIPFAKCSRVVSRSPPPRLPSQSLRPMPQRYGDVFWKNLNQRPTPTWLEEQHIPPMLLPPPEMLWRR |
|
WB Image Caption 1 |