Anti-NCOA3
Catalog Number:
ATA-HPA024210
- Images (8)
| Article Name: | Anti-NCOA3 |
| Biozol Catalog Number: | ATA-HPA024210 |
| Supplier Catalog Number: | HPA024210 |
| Alternative Catalog Number: | ATA-HPA024210-100,ATA-HPA024210-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ChIP, ICC, IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | ACTR, AIB1, bHLHe42, CAGH16, KAT13B, p/CIP, RAC3, SRC-3, SRC3, TNRC16, TRAM-1 |
| nuclear receptor coactivator 3 |
| Anti-NCOA3 |
| Clonality: | Polyclonal |
| Concentration: | 0.3 mg/ml |
| Isotype: | IgG |
| NCBI: | 8202 |
| UniProt: | Q9Y6Q9 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | PSKVSNQDSKSPLGFYCDQNPVESSMCQSNSRDHLSDKESKESSVEGAENQRGPLESKGHKKLLQLLTCSSDDRGHSSLTNSPLDSSCKESSVSVTSPSGVSSSTSGGVSSTSNMHGSLLQEKHRILHKLL |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | NCOA3 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol. |
|
|
Immunohistochemical staining of human placenta shows strong nuclear positivity in trophoblastic cells. |
|
|
Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10 Lane 2: Human cell line MCF-7 |
|
|
HPA024210-100ul |
|
|
|
|
|
|
|
|
HPA024210-100ul |
|
|
HPA024210-100ul |
Product Guarantee and Expert Support
