Anti-RHPN1

Catalog Number: ATA-HPA024288
Article Name: Anti-RHPN1
Biozol Catalog Number: ATA-HPA024288
Supplier Catalog Number: HPA024288
Alternative Catalog Number: ATA-HPA024288-100,ATA-HPA024288-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: KIAA1929, ODF5, RHPN
rhophilin, Rho GTPase binding protein 1
Anti-RHPN1
Clonality: Polyclonal
Concentration: 0.05 mg/ml
Isotype: IgG
NCBI: 114822
UniProt: Q8TCX5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: EVVTELKAAGEAGASLQVVSLLPSSRLPSLGDRRPVLLGPRGLLRSQREHGCKTPASTWASPRPLLNWSRKAQQGKTGGCPQPCAPVKPAP
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: RHPN1
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50
Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Immunohistochemical staining of human small intestine shows strong cytoplasmic positivity in glandular cells.
HPA024288-100ul
HPA024288-100ul