Anti-RABEPK

Catalog Number: ATA-HPA024415
Article Name: Anti-RABEPK
Biozol Catalog Number: ATA-HPA024415
Supplier Catalog Number: HPA024415
Alternative Catalog Number: ATA-HPA024415-100,ATA-HPA024415-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: bA65N13.1, RAB9P40
Clonality: Polyclonal
Concentration: 0,05
NCBI: 10244
UniProt: Q7Z6M1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: MKQLPVLEPGDKPRKATWYTLTVPGDSPCARVGHSCSYLPPVGNAKRGKVFIVGGANPNRSFSDVHTMDLGKHQWDLDTCKGLLPRYEHASFIPSCTP
Target: RABEPK
HPA024415-100ul