Anti-TAX1BP1
Catalog Number:
ATA-HPA024432
- Images (8)
| Article Name: | Anti-TAX1BP1 |
| Biozol Catalog Number: | ATA-HPA024432 |
| Supplier Catalog Number: | HPA024432 |
| Alternative Catalog Number: | ATA-HPA024432-100,ATA-HPA024432-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | CALCOCO3, TXBP151 |
| Tax1 (human T-cell leukemia virus type I) binding protein 1 |
| Anti-TAX1BP1 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 8887 |
| UniProt: | Q86VP1 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | ADAVAELKLNAMKKDQDKTDTLEHELRREVEDLKLRLQMAADHYKEKFKECQRLQKQINKLSDQSANNNNVFTKKTGNQQKVNDASVNTDPATSASTVDVKPSPSAAEADFDIVTKGQVCEMTKEIADKTEKYNK |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | TAX1BP1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200 |
|
|
Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol. |
|
|
Immunohistochemical staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts. |
|
|
Immunohistochemical staining of human prostate shows strong cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells. |
|
|
HPA024432-100ul |
|
|
|
|
|
HPA024432-100ul |
|
|
HPA024432-100ul |
Product Guarantee and Expert Support
