Anti-RSAD1

Catalog Number: ATA-HPA024459
Article Name: Anti-RSAD1
Biozol Catalog Number: ATA-HPA024459
Supplier Catalog Number: HPA024459
Alternative Catalog Number: ATA-HPA024459-100,ATA-HPA024459-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: FLJ11164
Clonality: Polyclonal
Isotype: IgG
NCBI: 55316
UniProt: Q9HA92
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: DHLSLYQLSLERGTALFAQVQRGALPAPDPELAAEMYQRGRAVLREAGFHQYEVSNFARNGALSTHNWTYWQCGQYLGVGPGAHGRFMPQG
Target: RSAD1
Antibody Type: Monoclonal Antibody
HPA024459-100ul