Anti-LPIN1

Catalog Number: ATA-HPA024591
Article Name: Anti-LPIN1
Biozol Catalog Number: ATA-HPA024591
Supplier Catalog Number: HPA024591
Alternative Catalog Number: ATA-HPA024591-100,ATA-HPA024591-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: KIAA0188
Clonality: Polyclonal
Isotype: IgG
NCBI: 23175
UniProt: Q14693
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: QEVIPMHLATSPILSEGASRMECQLKRGSVDRMRGLDPSTPAQVIAPSETPSSSSVVKKRRKRRRKSQLDSLKRDDNMNTSEDEDMFPIEMSSDEAMELLESSRTLPNDIPPFQDDIPEENLSLAVIYPQSA
Target: LPIN1
Antibody Type: Monoclonal Antibody
HPA024591-100ul