Anti-IARS2

Catalog Number: ATA-HPA024596
Article Name: Anti-IARS2
Biozol Catalog Number: ATA-HPA024596
Supplier Catalog Number: HPA024596
Alternative Catalog Number: ATA-HPA024596-100
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: FLJ10326
isoleucyl-tRNA synthetase 2, mitochondrial
Anti-IARS2
Clonality: Polyclonal
Concentration: 0.05 mg/ml
Isotype: IgG
NCBI: 55699
UniProt: Q9NSE4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: ALNGMVEMMDRRPYWCISRQRVWGVPIPVFHHKTKDEYLINSQTTEHIVKLVEQHGSDIWWTLPPEQLLPKEVLSEVGGPDALEYVPGQD
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: IARS2
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line A-431 shows localization to mitochondria.
Immunohistochemical staining of human colon shows strong cytoplasmic positivity with a granular pattern in glandular cells.
Western blot analysis using Anti-IARS2 antibody HPA024596 (A) shows similar pattern to independent antibody HPA024212 (B).
Western blot analysis in human cell line HEK 293.
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
HPA024596-100ul
HPA024596-100ul
HPA024596-100ul