Anti-ZBTB18

Catalog Number: ATA-HPA024656
Article Name: Anti-ZBTB18
Biozol Catalog Number: ATA-HPA024656
Supplier Catalog Number: HPA024656
Alternative Catalog Number: ATA-HPA024656-100,ATA-HPA024656-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: C2H2-171, RP58, TAZ-1, ZNF238
Clonality: Polyclonal
Isotype: IgG
NCBI: 10472
UniProt: Q99592
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: SYLHMYDIVKVCKKKLKEKATTEADSTKKEEDASSCSDKVESLSDGSSHIAGDLPSDEDEGEDEKLNILPSKRDLAAEPGNMWMRLPSDSAGIPQAGGEAEPHATAAGKTVASPCSSTESLSQRSVTSVRDSADVDCVLDLS
Target: ZBTB18
Antibody Type: Monoclonal Antibody
HPA024656-100ul