Anti-VPS28
Catalog Number:
ATA-HPA024745
- Images (8)
| Article Name: | Anti-VPS28 |
| Biozol Catalog Number: | ATA-HPA024745 |
| Supplier Catalog Number: | HPA024745 |
| Alternative Catalog Number: | ATA-HPA024745-100,ATA-HPA024745-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | VPS28 |
| vacuolar protein sorting 28 homolog (S. cerevisiae) |
| Anti-VPS28 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 51160 |
| UniProt: | Q9UK41 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | VQYKAAFRQVQGSEISSIDEFCRKFRLDCPLAMERIKEDRPITIKDDKGNLNRCIADVVSLFITVMDKLRLEIR |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | VPS28 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human duodenum and pancreas tissues using Anti-VPS28 antibody. Corresponding VPS28 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human duodenum shows high expression. |
|
|
Immunohistochemical staining of human pancreas shows low expression as expected. |
|
|
Western blot analysis using Anti-VPS28 antibody HPA024745 (A) shows similar pattern to independent antibody HPA024688 (B). |
|
|
HPA024745-100ul |
|
|
|
|
|
HPA024745-100ul |
|
|
HPA024745-100ul |
Product Guarantee and Expert Support
