Anti-ERICH5

Catalog Number: ATA-HPA025070
Article Name: Anti-ERICH5
Biozol Catalog Number: ATA-HPA025070
Supplier Catalog Number: HPA025070
Alternative Catalog Number: ATA-HPA025070-100,ATA-HPA025070-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: C8orf47, FLJ39553
glutamate-rich 5
Anti-ERICH5
Clonality: Polyclonal
Concentration: 0.2 mg/ml
Isotype: IgG
NCBI: 203111
UniProt: Q6P6B1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: QPQGTVGKDEQAPLLETISKENESPEILEGSQFVETAEEQQLQATLGKEEQPQLLERIPKENVTPEVLDRSQLVEK
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: ERICH5
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:2500 - 1:5000, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human fallopian tube and cerebral cortex tissues using Anti-ERICH5 antibody. Corresponding ERICH5 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human cerebral cortex shows low expression as expected.
Immunohistochemical staining of human fallopian tube shows high expression.
Western blot analysis in human cell line RT-4.
Western blot analysis in control (vector only transfected HEK293T lysate) and ERICH5 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY406460).
HPA025070-100ul
HPA025070-100ul
HPA025070-100ul