Anti-TSPOAP1
Catalog Number:
ATA-HPA025244
- Images (8)
| Article Name: | Anti-TSPOAP1 |
| Biozol Catalog Number: | ATA-HPA025244 |
| Supplier Catalog Number: | HPA025244 |
| Alternative Catalog Number: | ATA-HPA025244-100,ATA-HPA025244-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | BZRAP1, KIAA0612, PRAX-1, RIM-BP1, RIMBP1 |
| TSPO associated protein 1 |
| Anti-TSPOAP1 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 9256 |
| UniProt: | O95153 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | RTASTSTLGEKDPGPAAPSLAKQEAEWTAGEACPASSSTQGARAQQAPNTEMCQGGDPGSGLRPRAEKEDTAELGVHLVNSLVDHGRNSDLSD |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | TSPOAP1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:20 - 1:50 |
|
|
Immunohistochemical staining of human cerebral cortex, fallopian tube, pancreas and rectum using Anti-TSPOAP1 antibody HPA025244 (A) shows similar protein distribution across tissues to independent antibody HPA024662 (B). |
|
|
Immunohistochemical staining of human cerebral cortex using Anti-TSPOAP1 antibody HPA025244. |
|
|
Immunohistochemical staining of human pancreas using Anti-TSPOAP1 antibody HPA025244. |
|
|
Immunohistochemical staining of human fallopian tube using Anti-TSPOAP1 antibody HPA025244. |
|
|
Immunohistochemical staining of human rectum using Anti-TSPOAP1 antibody HPA025244. |
|
|
HPA025244-100ul |
|
|
HPA025244-100ul |
|
|
HPA025244-100ul |
Product Guarantee and Expert Support
