Anti-DDX42
Catalog Number:
ATA-HPA025941
- Images (8)
| Article Name: | Anti-DDX42 |
| Biozol Catalog Number: | ATA-HPA025941 |
| Supplier Catalog Number: | HPA025941 |
| Alternative Catalog Number: | ATA-HPA025941-100 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | ICC, IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | RHELP, RNAHP, SF3b125, SF3B8 |
| DEAD (Asp-Glu-Ala-Asp) box helicase 42 |
| Anti-DDX42 |
| Clonality: | Polyclonal |
| Concentration: | 0.05 mg/ml |
| Isotype: | IgG |
| NCBI: | 11325 |
| UniProt: | Q86XP3 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | TAGVVQEEEEDNLEYDSDGNPIAPTKKIIDPLPPIDHSEIDYPPFEKNFYNEHEEITNLTPQQLIDLRHKLNLRVSGAAPPRPGSSFAHFGFDEQLMHQIRKSEYTQPTPIQCQG |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | DDX42 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50 |
|
|
Immunofluorescent staining of human cell line U-251 MG shows localization to nuclear speckles. |
|
|
Immunohistochemical staining of human fallopian tube shows strong nuclear positivity in glandular cells. |
|
|
Western blot analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-DDX42 antibody. Remaining relative intensity is presented. |
|
|
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells) |
|
|
HPA025941-100ul |
|
|
|
|
|
HPA025941-100ul |
|
|
HPA025941-100ul |
Product Guarantee and Expert Support
