Anti-ARMC1 Antibody , Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-ARMC1 Antibody , Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA026085
• Supplier Catalog Number: HPA026085
• Alternative Catalog Number: ATA-HPA026085-100,ATA-HPA026085-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: ICC, IHC, WB
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: Arcp, FLJ10511

Product Description

armadillo repeat containing 1

Additional Information

Anti-ARMC1

Product Properties

• Clonality: Polyclonal
• Concentration: 0.1 mg/ml
• Isotype: IgG
• NCBI: 55156
• UniProt: Q9NVT9
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: SSTSTMSEEPDALSVVNQLRDLAADPLNRRAIVQDQGCLPGLILFMDHPNPPVVHSALLALRYLAECRANREKMKGELGMMLSLQNVIQKTTTPGETKLLASEIYDILQSSNMADGDSFNEMNSRRRKAQFFLGTTNKRA
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: ARMC1
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml

Images

Immunofluorescent staining of human cell line A-431 shows localization to mitochondria.

Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in distal tubules.

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
Lane 4: Human plasma (IgG/HSA depleted)
Lane 5: Human liver tissue
Lane 6: Human tonsil tissue

Western blot analysis in control (vector only transfected HEK293T lysate) and ARMC1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY413306).

HPA026085

HPA026085

HPA026085