Anti-HTT
Catalog Number:
ATA-HPA026114
- Images (8)
| Article Name: | Anti-HTT |
| Biozol Catalog Number: | ATA-HPA026114 |
| Supplier Catalog Number: | HPA026114 |
| Alternative Catalog Number: | ATA-HPA026114-100,ATA-HPA026114-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | ICC, IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | HD, IT15 |
| huntingtin |
| Anti-HTT |
| Clonality: | Polyclonal |
| Concentration: | 0.05 mg/ml |
| Isotype: | IgG |
| NCBI: | 3064 |
| UniProt: | P42858 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | LQQAHLLKNMSHCRQPSDSSVDKFVLRDEATEPGDQENKPCRIKGDIGQSTDDDSAPLVHCVRLLSASFLLTGGKNVLVPDRDVRVSVKALALSCVGAAVALHPESFFSKLYKVPLD |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | HTT |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50 |
|
|
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol. |
|
|
Immunohistochemistry analysis in human cerebral cortex and liver tissues using Anti-HTT antibody. Corresponding HTT RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human cerebral cortex shows high expression. |
|
|
Immunohistochemical staining of human liver shows low expression as expected. |
|
|
HPA026114-100ul |
|
|
|
|
|
HPA026114-100ul |
|
|
HPA026114-100ul |
Product Guarantee and Expert Support
