Anti-CAMSAP2
Catalog Number:
ATA-HPA026304
- Images (8)
| Article Name: | Anti-CAMSAP2 |
| Biozol Catalog Number: | ATA-HPA026304 |
| Supplier Catalog Number: | HPA026304 |
| Alternative Catalog Number: | ATA-HPA026304-100,ATA-HPA026304-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | CAMSAP1L1, KIAA1078 |
| calmodulin regulated spectrin-associated protein family, member 2 |
| Anti-CAMSAP2 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 23271 |
| UniProt: | Q08AD1 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | SSVHGVSFDISFDKEDSVQRSTPNRGITRSISNEGLTLNNSHVSKHIRKNLSFKPINGEEEAESIEEELNIDSHSDLKSCVPL |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | CAMSAP2 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemical staining of human cerebral cortex, colon, lymph node and testis using Anti-CAMSAP2 antibody HPA026304 (A) shows similar protein distribution across tissues to independent antibody HPA026511 (B). |
|
|
Immunohistochemical staining of human testis using Anti-CAMSAP2 antibody HPA026304. |
|
|
Immunohistochemical staining of human cerebral cortex using Anti-CAMSAP2 antibody HPA026304. |
|
|
Immunohistochemical staining of human colon using Anti-CAMSAP2 antibody HPA026304. |
|
|
Immunohistochemical staining of human lymph node using Anti-CAMSAP2 antibody HPA026304. |
|
|
HPA026304-100ul |
|
|
HPA026304-100ul |
|
|
HPA026304-100ul |
Product Guarantee and Expert Support
