Anti-API5

Catalog Number: ATA-HPA026598
Article Name: Anti-API5
Biozol Catalog Number: ATA-HPA026598
Supplier Catalog Number: HPA026598
Alternative Catalog Number: ATA-HPA026598-100,ATA-HPA026598-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC, IHC, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: AAC-11, AAC11, API5L1
apoptosis inhibitor 5
Anti-API5
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 8539
UniProt: Q9BZZ5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: TVEELYRNYGILADATEQVGQHKDAYQVILDGVKGGTKEKRLAAQFIPKFFKHFPELADSAINAQLDLCEDEDVSIRRQAIKELPQFATGENLPRVADILTQLLQTDDSAEFNLVN
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: API5
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-2 OS shows localization to nuclear speckles.
Immunohistochemical staining of human urinary bladder shows strong nuclear positivity in urothelial cells.
Western blot analysis in human cell line NTERA-2.
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
HPA026598-100ul
HPA026598-100ul
HPA026598-100ul