Anti-RUBCNL

Catalog Number: ATA-HPA026614
Article Name: Anti-RUBCNL
Biozol Catalog Number: ATA-HPA026614
Supplier Catalog Number: HPA026614
Alternative Catalog Number: ATA-HPA026614-100,ATA-HPA026614-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC, IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: C13orf18, FLJ21562, KIAA0226L
RUN and cysteine rich domain containing beclin 1 interacting protein like
Anti-RUBCNL
Clonality: Polyclonal
Concentration: 0.3 mg/ml
Isotype: IgG
NCBI: 80183
UniProt: Q9H714
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: AVQVSRRTISSNSFSPEVFVLPVDVEKENAHFYVADMIISAMEKMKCNILSQQQTESWSKEVSGLLGSDQPDSEMTFDTNIKQESGSSTSSYSGYEGCAVLQVSPVTETRTYHDVKEICKCDVDEFVILELGDF
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: RUBCNL
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol.
Immunohistochemical staining of human duodenum shows moderate cytoplasmic positivity in glandular cells.
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
Lane 4: Human plasma (IgG/HSA depleted)
Lane 5: Human liver tissue
Lane 6: Human tonsil tissue
HPA026614-100ul
HPA026614-100ul
HPA026614-100ul