Anti-ADPRS

Catalog Number: ATA-HPA026641
Article Name: Anti-ADPRS
Biozol Catalog Number: ATA-HPA026641
Supplier Catalog Number: HPA026641
Alternative Catalog Number: ATA-HPA026641-100
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: ARH3, FLJ20446, ADPRHL2
Clonality: Polyclonal
Isotype: IgG
NCBI: 54936
UniProt: Q9NX46
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: FKKLLNPKCRDVFEPARAQFNGKGSYGNGGAMRVAGISLAYSSVQDVQKFARLSAQLTHASSLGYNGAILQALAVHLALQGES
Target: ADPRS
Antibody Type: Monoclonal Antibody
HPA026641-100ul