Anti-NTS
Catalog Number:
ATA-HPA026664
- Images (8)
| Article Name: | Anti-NTS |
| Biozol Catalog Number: | ATA-HPA026664 |
| Supplier Catalog Number: | HPA026664 |
| Alternative Catalog Number: | ATA-HPA026664-100,ATA-HPA026664-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | NTS |
| neurotensin |
| Anti-NTS |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 4922 |
| UniProt: | P30990 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | DFLTNMHTSKLIQEDILDTGNDKNGKEEVIKRKIPYILKRQLYENKPRRP |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | NTS |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemistry analysis in human small intestine and skeletal muscle tissues using HPA026664 antibody. Corresponding NTS RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human small intestine shows strong cytoplasmic positivity in endocrine glandular cells. |
|
|
Immunohistochemical staining of human tonsil shows no positivity in lymphoid cells as expected. |
|
|
Immunohistochemical staining of human pancreas shows no positivity in exocrine glandular cells as expected. |
|
|
Immunohistochemical staining of human skeletal muscle shows no positivity in striated muscle fibers as expected. |
|
|
HPA026664-100ul |
|
|
HPA026664-100ul |
|
|
HPA026664-100ul |
Product Guarantee and Expert Support
