Anti-SH3GL2

Catalog Number: ATA-HPA026685
Article Name: Anti-SH3GL2
Biozol Catalog Number: ATA-HPA026685
Supplier Catalog Number: HPA026685
Alternative Catalog Number: ATA-HPA026685-100,ATA-HPA026685-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: CNSA2, EEN-B1, SH3D2A, SH3P4
SH3-domain GRB2-like 2
Anti-SH3GL2
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 6456
UniProt: Q99962
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: ALVQAQLEYHKQAVQILQQVTVRLEERIRQASSQPRREYQPKPRMSLEFPTGDSTQPNGGLSHTGTPKPSGVQMDQPCCRALYDFEPENEGELG
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: SH3GL2
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human cerebral cortex and pancreas tissues using Anti-SH3GL2 antibody. Corresponding SH3GL2 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human cerebral cortex shows high expression.
Immunohistochemical staining of human pancreas shows low expression as expected.
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: Human cell line RT-4
HPA026685-100ul
HPA026685-100ul
HPA026685-100ul