Anti-SPACA1
Catalog Number:
ATA-HPA026744
- Images (12)
| Article Name: | Anti-SPACA1 |
| Biozol Catalog Number: | ATA-HPA026744 |
| Supplier Catalog Number: | HPA026744 |
| Alternative Catalog Number: | ATA-HPA026744-100,ATA-HPA026744-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | SAMP32 |
| sperm acrosome associated 1 |
| Anti-SPACA1 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 81833 |
| UniProt: | Q9HBV2 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | REVILTNGCPGGESKCVVRVEECRGPTDCGWGKPISESLESVRLACIHTSPLNRFKYMWKL |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | SPACA1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human testis and endometrium tissues using Anti-SPACA1 antibody. Corresponding SPACA1 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human cerebral cortex, kidney, liver and testis using Anti-SPACA1 antibody HPA026744 (A) shows similar protein distribution across tissues to independent antibody HPA043297 (B). |
|
|
Immunohistochemical staining of human endometrium shows low expression as expected. |
|
|
Immunohistochemical staining of human testis shows high expression. |
|
|
Immunohistochemical staining of human kidney using Anti-SPACA1 antibody HPA026744. |
|
|
Immunohistochemical staining of human cerebral cortex using Anti-SPACA1 antibody HPA026744. |
|
|
Immunohistochemical staining of human liver using Anti-SPACA1 antibody HPA026744. |
|
|
Western blot analysis in control (vector only transfected HEK293T lysate) and SPACA1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY410624). |
|
|
HPA026744-100ul |
|
|
|
|
|
HPA026744-100ul |
|
|
HPA026744-100ul |
Product Guarantee and Expert Support
