Anti-SMUG1

Catalog Number: ATA-HPA026804
Article Name: Anti-SMUG1
Biozol Catalog Number: ATA-HPA026804
Supplier Catalog Number: HPA026804
Alternative Catalog Number: ATA-HPA026804-100,ATA-HPA026804-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: FDG, HMUDG, UNG3
Clonality: Polyclonal
Isotype: IgG
NCBI: 23583
UniProt: Q53HV7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: QPEVFFHHCFVHNLCPLLFLAPSGRNLTPAELPAKQREQLLGICDAALCRQVQLLGVRLVVGVGRLAEQRARRALAGLMPEVQVEGLLHPSPRNPQANKGWEAVAKERLNELGLL
Target: SMUG1
Antibody Type: Monoclonal Antibody
HPA026804-100ul