Anti-SEC11C
Catalog Number:
ATA-HPA026816
- Images (7)
| Article Name: | Anti-SEC11C |
| Biozol Catalog Number: | ATA-HPA026816 |
| Supplier Catalog Number: | HPA026816 |
| Alternative Catalog Number: | ATA-HPA026816-100,ATA-HPA026816-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | SEC11L3, SPC21, SPCS4C |
| SEC11 homolog C (S. cerevisiae) |
| Anti-SEC11C |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 90701 |
| UniProt: | Q9BY50 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | MVRAGAVGAHLPASGLDIFGDLKKMNKRQLYYQV |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | SEC11C |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human lymph node shows strong cytoplasmic positivity in subsets of lymphoid cells outside reaction centra. |
|
|
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251MG sp Lane 4: Human plasma (IgG/HSA depleted) Lane 5: Human liver tissue Lane 6: Human tonsil tissue |
|
|
Western blot analysis in control (vector only transfected HEK293T lysate) and SEC11C over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY403241). |
|
|
HPA026816-100ul |
|
|
|
|
|
HPA026816-100ul |
|
|
HPA026816-100ul |
Product Guarantee and Expert Support
