Anti-NDST2

Product Overview

• Article Name: Anti-NDST2
• Biozol Catalog Number: ATA-HPA027033
• Supplier Catalog Number: HPA027033
• Alternative Catalog Number: ATA-HPA027033-100
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Sonstiges
• Application: WB
• Species Reactivity: Human
• Alternative Names: HSST2, NST2

Product Description

Rabbit Polyclonal NDST2 Antibody against Human N-deacetylase and N-sulfotransferase 2. Validated for Western Blot

Product Properties

• Clonality: Polyclonal
• Concentration: 0.05
• NCBI: 8509
• UniProt: P52849
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Sequence: IITVLTNPADRAYSWYQHQRAHGDPVALNYTFYQVISASSQTPLALRSLQNRCLVPGYYSTHLQRWLTYYPSGQLLIVDGQELRTNPAASMESIQKFLGITPFLNYTRTLRFDDDKGFWCQGLEGGKT