Anti-TSEN2

Catalog Number: ATA-HPA027120
Article Name: Anti-TSEN2
Biozol Catalog Number: ATA-HPA027120
Supplier Catalog Number: HPA027120
Alternative Catalog Number: ATA-HPA027120-100,ATA-HPA027120-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: MGC2776, SEN2, SEN2L
TSEN2 tRNA splicing endonuclease subunit
Anti-TSEN2
Clonality: Polyclonal
Concentration: 0.4 mg/ml
Isotype: IgG
NCBI: 80746
UniProt: Q8NCE0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: VFHAPKRKRRVYETYESPLPIPFGQDHGPLKEFKIFRAEMINNNVIVRNAEDIEQLYGKGYFGKGILSRSRPSFTISDPKLVAKWKD
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: TSEN2
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm, cytosol & centrosome.
Immunohistochemical staining of human cerebellum shows distinct nuclear positivity in Purkinje cells.
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
HPA027120-100ul
HPA027120-100ul
HPA027120-100ul