Anti-GORAB

Catalog Number: ATA-HPA027250
Article Name: Anti-GORAB
Biozol Catalog Number: ATA-HPA027250
Supplier Catalog Number: HPA027250
Alternative Catalog Number: ATA-HPA027250-100,ATA-HPA027250-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: FLJ11752, GO, NTKL-BP1, SCYL1BP1
golgin, RAB6-interacting
Anti-GORAB
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 92344
UniProt: Q5T7V8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: FSSPTLPSHFTLTSPVGDGQPQGIESQPKELGLENSHDGHNNVEILPPKPDCKLEKKKVELQEKSRWEVLQQEQRLME
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: GORAB
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm, cytosol & the Golgi apparatus.
Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
Western blot analysis in control (vector only transfected HEK293T lysate) and GORAB over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY407701).
HPA027250-100ul
HPA027250-100ul
HPA027250-100ul