Anti-CCDC181

Catalog Number: ATA-HPA027275
Article Name: Anti-CCDC181
Biozol Catalog Number: ATA-HPA027275
Supplier Catalog Number: HPA027275
Alternative Catalog Number: ATA-HPA027275-100,ATA-HPA027275-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: C1orf114, FLJ25846
coiled-coil domain containing 181
Anti-CCDC181
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 57821
UniProt: Q5TID7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: FELLNLQDIASQGFLPPINNANSTENDPQQLLPRSSNSSVSGTKKEDSTAKIHAVTHSSTGEPLAYIAQPPLNRKTCPSSAVNSDRSKGN
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: CCDC181
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:200 - 1:500
Immunohistochemistry analysis in human fallopian tube and prostate tissues using Anti-CCDC181 antibody. Corresponding CCDC181 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human bronchus, fallopian tube, liver and prostate using Anti-CCDC181 antibody HPA027275 (A) shows similar protein distribution across tissues to independent antibody HPA027189 (B).
Immunohistochemical staining of human prostate shows low expression as expected.
Immunohistochemical staining of human fallopian tube shows high expression.
Immunohistochemical staining of human liver using Anti-CCDC181 antibody HPA027275.
Immunohistochemical staining of human bronchus using Anti-CCDC181 antibody HPA027275.
HPA027275-100ul
HPA027275-100ul
HPA027275-100ul