Anti-COQ8B Antibody , Unconjugated, Rabbit, Polyclonal
Catalog Number:
ATA-HPA027279
- Images (9)
| Article Name: | Anti-COQ8B Antibody , Unconjugated, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA027279 |
| Supplier Catalog Number: | HPA027279 |
| Alternative Catalog Number: | ATA-HPA027279-100,ATA-HPA027279-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human, Mouse, Rat |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | ADCK4, COQ8, FLJ12229 |
| coenzyme Q8B |
| Anti-COQ8B |
| Clonality: | Polyclonal |
| Concentration: | 0.4 mg/ml |
| Isotype: | IgG |
| NCBI: | 79934 |
| UniProt: | Q96D53 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | RQSADFMPRWQMLRVLEEELGRDWQAKVASLEEVPFAAASIGQVHQGLLRDGTEVAVKIQY |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | COQ8B |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human fallopian tube and skeletal muscle tissues using Anti-COQ8B antibody. Corresponding COQ8B RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human skeletal muscle shows low expression as expected. |
|
|
Immunohistochemical staining of human fallopian tube shows high expression. |
|
|
Western blot analysis using Anti-COQ8B antibody HPA027279 (A) shows similar pattern to independent antibody HPA028303 (B). |
|
|
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II. |
|
|
HPA027279 |
|
|
|
|
|
HPA027279 |
|
|
HPA027279 |
Product Guarantee and Expert Support
