Anti-COQ8B

Catalog Number: ATA-HPA027279
Article Name: Anti-COQ8B
Biozol Catalog Number: ATA-HPA027279
Supplier Catalog Number: HPA027279
Alternative Catalog Number: ATA-HPA027279-100,ATA-HPA027279-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: ADCK4, COQ8, FLJ12229
coenzyme Q8B
Anti-COQ8B
Clonality: Polyclonal
Concentration: 0.4 mg/ml
Isotype: IgG
NCBI: 79934
UniProt: Q96D53
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: RQSADFMPRWQMLRVLEEELGRDWQAKVASLEEVPFAAASIGQVHQGLLRDGTEVAVKIQY
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: COQ8B
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human fallopian tube and skeletal muscle tissues using Anti-COQ8B antibody. Corresponding COQ8B RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human skeletal muscle shows low expression as expected.
Immunohistochemical staining of human fallopian tube shows high expression.
Western blot analysis using Anti-COQ8B antibody HPA027279 (A) shows similar pattern to independent antibody HPA028303 (B).
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
HPA027279-100ul
HPA027279-100ul
HPA027279-100ul