Anti-SIRT7

Catalog Number: ATA-HPA027284
Article Name: Anti-SIRT7
Biozol Catalog Number: ATA-HPA027284
Supplier Catalog Number: HPA027284
Alternative Catalog Number: ATA-HPA027284-100,ATA-HPA027284-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Clonality: Polyclonal
Isotype: IgG
NCBI: 51547
UniProt: Q9NRC8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: LVVYTGAGISTAASIPDYRGPNGVWTLLQKGRSVSAADLSEAEPTLTHMSITRLHEQKLVQHVVSQNCDGLHLRSGLPRTAISE
Target: SIRT7
Antibody Type: Monoclonal Antibody
HPA027284-100ul