Anti-DLGAP3

Catalog Number: ATA-HPA027304
Article Name: Anti-DLGAP3
Biozol Catalog Number: ATA-HPA027304
Supplier Catalog Number: HPA027304
Alternative Catalog Number: ATA-HPA027304-100,ATA-HPA027304-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: DAP3, SAPAP3
Clonality: Polyclonal
Isotype: IgG
NCBI: 58512
UniProt: O95886
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: PKTSPKAVARRFTTRRSSSVDQARINCCVPPRIHPRSSIPGYSRSLTTGQLSDELNQQLEAVCGSVFGELES
Target: DLGAP3
Antibody Type: Monoclonal Antibody
HPA027304-100ul