Anti-TRIT1

Catalog Number: ATA-HPA027330
Article Name: Anti-TRIT1
Biozol Catalog Number: ATA-HPA027330
Supplier Catalog Number: HPA027330
Alternative Catalog Number: ATA-HPA027330-100,ATA-HPA027330-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: FLJ20061, IPT
Clonality: Polyclonal
Isotype: IgG
NCBI: 54802
UniProt: Q9H3H1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: KNVSENSQDYQHGIFQSIGFKEFHEYLITEGKCTLETSNQLLKKGIEALKQVTKRYARKQNRWVKNRFLSRPGPIVPPVYGLEVSDVSKWE
Target: TRIT1
Antibody Type: Monoclonal Antibody
HPA027330-100ul