Anti-ORC1

Catalog Number: ATA-HPA027439
Article Name: Anti-ORC1
Biozol Catalog Number: ATA-HPA027439
Supplier Catalog Number: HPA027439
Alternative Catalog Number: ATA-HPA027439-100,ATA-HPA027439-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: HSORC1, ORC1L, PARC1
Clonality: Polyclonal
Isotype: IgG
NCBI: 4998
UniProt: Q13415
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: LEEATFQQIYSQHVALCRMEGLPYPTMSETMAVCSHLGSCRLLLVEPSRNDLLLRVRLNVSQDDVLYA
Target: ORC1
Antibody Type: Monoclonal Antibody
HPA027439-100ul