Anti-THEMIS2

Catalog Number: ATA-HPA027513
Article Name: Anti-THEMIS2
Biozol Catalog Number: ATA-HPA027513
Supplier Catalog Number: HPA027513
Alternative Catalog Number: ATA-HPA027513-100,ATA-HPA027513-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: C1orf38, ICB-1
Clonality: Polyclonal
Isotype: IgG
NCBI: 9473
UniProt: Q5TEJ8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: GEREENPEFTSLAVGDRLEVLGPGQAHGAQGSDVDVLVCQRLSDQAGEDEEEECKEEAESPERVLLPFHFPGSF
Target: THEMIS2
Antibody Type: Monoclonal Antibody
HPA027513-100ul