Anti-RCC1

Catalog Number: ATA-HPA027573
Article Name: Anti-RCC1
Biozol Catalog Number: ATA-HPA027573
Supplier Catalog Number: HPA027573
Alternative Catalog Number: ATA-HPA027573-100,ATA-HPA027573-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC, IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: CHC1
regulator of chromosome condensation 1
Anti-RCC1
Clonality: Polyclonal
Concentration: 0.05 mg/ml
Isotype: IgG
NCBI: 1104
UniProt: P18754
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: IPKSKKVKVSHRSHSTEPGLVLTLGQGDVGQLGLGENVMERKKPALVSIPEDVVQAEAGGMHTVCLSKSGQVYSFGCNDE
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: RCC1
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemical staining of human urinary bladder shows strong nuclear positivity in urothelial cells.
Western blot analysis using Anti-RCC1 antibody HPA027573 (A) shows similar pattern to independent antibody HPA027574 (B).
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
HPA027573-100ul
HPA027573-100ul
HPA027573-100ul