Anti-S100A14
Catalog Number:
ATA-HPA027613
- Images (9)
| Article Name: | Anti-S100A14 |
| Biozol Catalog Number: | ATA-HPA027613 |
| Supplier Catalog Number: | HPA027613 |
| Alternative Catalog Number: | ATA-HPA027613-100,ATA-HPA027613-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | ICC, IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | BCMP84, S100A15 |
| S100 calcium binding protein A14 |
| Anti-S100A14 |
| Clonality: | Polyclonal |
| Concentration: | 0.3 mg/ml |
| Isotype: | IgG |
| NCBI: | 57402 |
| UniProt: | Q9HCY8 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | GQCRSANAEDAQEFSDVERAIETLIKNFHQYSVEGGKETLTPSELRDLVTQQLPHLMPSNCGLEEKIANLGSCNDSKLEFRSFWELIGEA |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | S100A14 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:2500 - 1:5000, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line MCF7 shows localization to nuclear bodies, plasma membrane, cytosol & cell junctions. |
|
|
Immunohistochemistry analysis in human esophagus and kidney tissues using Anti-S100A14 antibody. Corresponding S100A14 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human kidney shows low expression as expected. |
|
|
Immunohistochemical staining of human esophagus shows high expression. |
|
|
Western blot analysis in control (vector only transfected HEK293T lysate) and S100A14 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY402803). |
|
|
HPA027613-100ul |
|
|
|
|
|
HPA027613-100ul |
|
|
HPA027613-100ul |
Product Guarantee and Expert Support
