Anti-INKA2

Catalog Number: ATA-HPA027810
Article Name: Anti-INKA2
Biozol Catalog Number: ATA-HPA027810
Supplier Catalog Number: HPA027810
Alternative Catalog Number: ATA-HPA027810-100,ATA-HPA027810-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: C1orf183, FLJ31105, FAM212B
Clonality: Polyclonal
Isotype: IgG
NCBI: 55924
UniProt: Q9NTI7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: GWVTPMVPESRTGRSQKVKKRSLSKGSGHFPFPGTGEHRRGENPPTSCPKALEHSPSGFDINTAVW
Target: INKA2
Antibody Type: Monoclonal Antibody
HPA027810-100ul