Anti-CAMTA2

Catalog Number: ATA-HPA027835
Article Name: Anti-CAMTA2
Biozol Catalog Number: ATA-HPA027835
Supplier Catalog Number: HPA027835
Alternative Catalog Number: ATA-HPA027835-100,ATA-HPA027835-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: KIAA0909
Clonality: Polyclonal
Isotype: IgG
NCBI: 23125
UniProt: O94983
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: LPPASDDGAAPEDADSPQAVDVIPVDMISLAKQIIEATPERIKREDFVGLPEAGASMRERTGAVGLSETMSWLASYLENVDHFPSSTPPSELPFERGRLAVPSAPSWAEF
Target: CAMTA2
Antibody Type: Monoclonal Antibody
HPA027835-100ul