Anti-EEF1E1

Catalog Number: ATA-HPA027901
Article Name: Anti-EEF1E1
Biozol Catalog Number: ATA-HPA027901
Supplier Catalog Number: HPA027901
Alternative Catalog Number: ATA-HPA027901-100,ATA-HPA027901-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: AIMP3, P18
eukaryotic translation elongation factor 1 epsilon 1
Anti-EEF1E1
Clonality: Polyclonal
Concentration: 0.2 mg/ml
Isotype: IgG
NCBI: 9521
UniProt: O43324
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: LSLLEKSLGLSKGNKYSAQGERQIPVLQTNNGPSLTGLTTIAAHLVKQANKEYLLGSTAEEKAIVQQWLEYRVTQVDGHSSKNDIHTLLKDL
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: EEF1E1
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunohistochemical staining of human testis shows cytoplasmic positivity in cells in seminiferous ducts.
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
HPA027901-100ul
HPA027901-100ul
HPA027901-100ul