Anti-WARS2

Catalog Number: ATA-HPA028007
Article Name: Anti-WARS2
Biozol Catalog Number: ATA-HPA028007
Supplier Catalog Number: HPA028007
Alternative Catalog Number: ATA-HPA028007-100,ATA-HPA028007-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: TrpRS
Clonality: Polyclonal
Isotype: IgG
NCBI: 10352
UniProt: Q9UGM6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: VSNIVAVHAAVTGLSVEEVVRRSAGMNTARYKLAVADAVIEKFAPIKREIEKLKLDKDHLEKVLQIGSAKAKELAYTVCQEVKKLVG
Target: WARS2
Antibody Type: Monoclonal Antibody
HPA028007-100ul