Anti-NTPCR
Catalog Number:
ATA-HPA028125
| Article Name: |
Anti-NTPCR |
| Biozol Catalog Number: |
ATA-HPA028125 |
| Supplier Catalog Number: |
HPA028125 |
| Alternative Catalog Number: |
ATA-HPA028125-100 |
| Manufacturer: |
Atlas Antibodies |
| Host: |
Rabbit |
| Category: |
Molekularbiologie |
| Application: |
IHC, WB |
| Species Reactivity: |
Human |
| Immunogen: |
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: |
Unconjugated |
| Alternative Names: |
C1orf57, HCR-NTPase, MGC13186 |
| nucleoside-triphosphatase, cancer-related |
| Clonality: |
Polyclonal |
| Concentration: |
0.05 mg/ml |
| Isotype: |
IgG |
| NCBI: |
84284 |
| UniProt: |
Q9BSD7 |
| Buffer: |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: |
Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: |
LRNADCSSGPGQRVCVIDEIGKMELFSQLFIQAVRQTLSTPGTIILGTIPVPKGKPLALVEEIRN |
| Storage: |
Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: |
NTPCR |
| Antibody Type: |
Monoclonal Antibody |
| Application Dilute: |
IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml |
![]()
|
Immunohistochemical staining of human adrenal gland shows nuclear positivity in glandular cells. |
![]()
|
Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10
Lane 2: Human cell line HEK 293 |
![]()
|
HPA028125-100ul |
![]()
|
HPA028125-100ul |
