Anti-SNAP47

Catalog Number: ATA-HPA028167
Article Name: Anti-SNAP47
Biozol Catalog Number: ATA-HPA028167
Supplier Catalog Number: HPA028167
Alternative Catalog Number: ATA-HPA028167-100,ATA-HPA028167-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: C1orf142, SNAP-47, SVAP1
synaptosomal-associated protein, 47kDa
Anti-SNAP47
Clonality: Polyclonal
Concentration: 0.05 mg/ml
Isotype: IgG
NCBI: 116841
UniProt: Q5SQN1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: DDIKVHSPYEISIRQRFIGKPDMAYRLISAKMPEVIPILEVQFSKKMELLEDALVLRSARTSSPAEKSCSVWHAASGLMGRTLHREPPAGDQE
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: SNAP47
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50
Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemistry analysis in human endometrium and pancreas tissues using Anti-SNAP47 antibody. Corresponding SNAP47 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human endometrium shows high expression.
Immunohistochemical staining of human pancreas shows low expression as expected.
HPA028167-100ul
HPA028167-100ul
HPA028167-100ul